PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00123.1_g00037.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 354aa    MW: 38849.8 Da    PI: 8.8225
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00123.1_g00037.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.35.7e-072312761863
                              HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  18 rrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              +rsR RK+++i+eLe++v  L+a   +L  ++ +l ++ a+l  e+
  Rsa1.0_00123.1_g00037.1 231 QRSRVRKLQYIAELERRVSMLQAVEADLSVRVASLVQTRATLSLEN 276
                              69*********************************99999998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147033.62E-12227270No hitNo description
Gene3DG3DSA:1.20.5.1705.5E-4231282No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MSRPAQLPPR CPIPKKLSLN PFADTYYSSS SPVESYIAHH KPPTQDSTLE EQPAWLDELL  60
RDKTDGMMLL TGGGGGGGPP PPLPLRRSAS DSVVLLGDIS ADFAAGFNQS EDEESLTSEA  120
CGELESACVY GPNSPRAKNS SNFSDNPIAS AFSDYGSQKA RQNSDDALKG SNVPPVEENA  180
CGSMGVPNAK RSRLIYNGRG TLWFILGFVV KHRLVLGYIG KFVDDLWNPG QRSRVRKLQY  240
IAELERRVSM LQAVEADLSV RVASLVQTRA TLSLENSQMK QQMAILKQDK LIREGEYQLL  300
KKEAQRLNSR LRNIGSNNNN RLARSYSAGS SIGPRTASSH LDWNLLDLTK LNLN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0998811e-113AY099881.1 Arabidopsis thaliana unknown protein (At5g04840) mRNA, complete cds.
GenBankBT0087101e-113BT008710.1 Arabidopsis thaliana At5g04840 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013729394.11e-174PREDICTED: basic leucine zipper 2
TrEMBLA0A078I6X01e-174A0A078I6X0_BRANA; BnaC09g50830D protein
STRINGBra009426.1-P1e-169(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1364279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.27e-18bZIP family protein